PLAGL1
| Antigen Gene Symbol | PLAGL1 |
|---|---|
| Antigen Protein Name | pleiomorphic adenoma gene-like 1 |
| Antigen Source Species | E. coli |
| Antigen Source Species ID | 562 |
| Antigen Organism ID | |
| Antigen Uniprot AC | |
| Antigen Uniprot KB | |
| Antigen Synonym Names | Zinc finger protein PLAGL1 , Lost on transformation 1 , LOT-1 , Pleiomorphic adenoma-like protein 1 , Tumor suppressor ZAC |
| Antigen Synonyms | PLAGL1;LOT1;ZAC |
| Antigen Species | Homo sapiens |
| Antigen Species ID |
Domain Name: ZF_C2H2 Domain ID: HR7895A.004Antigen Source Lab ID: HR7895A.004 Antigen Source Lab: Rutgers Antigen Protein Sequence Position: 159 Antigen Protein Sequence: MSGLNDIFEAQKIEWHEHHHHHHENLYFQSHMDHCERCFYTRKDVRRHLVVHTGCKDFLCQFCAQRFGRKDHL Binders dropdown end: |
| HGNC | |
|---|---|
| GeneCards | |
| MGI | |
| MIM | |
| eggNOG | |
| INPARANOID | |
| TreeFam | |
| InterPro | |
| PFAM | |
| PROSITE | |
| SMART | |
| RefSeq | |
| Ensembl | |
| GeneID | |
| KEGG | |
| UCSC | |
| BioGrid | |
| STRING | |
| IntAct | |
| Mint | |
| DMDM | |
| ChiTaRS | |
| Antigen Citation |
Quick links
Latest publications
-
Conformation-specific Synthetic Antibodies Discriminate Multiple Functional States of the Ion Channel CorA. (published on 2023 Jul 01)
-
Structural basis for assembly and lipid-mediated gating of LRRC8A:C volume-regulated anion channels. (published on 2023 Mar 16)
