ATF4
| Antigen Gene Symbol | ATF4 |
|---|---|
| Antigen Protein Name | activating transcription factor 4 |
| Antigen Source Species | E. coli |
| Antigen Source Species ID | 562 |
| Antigen Organism ID | |
| Antigen Uniprot AC | |
| Antigen Uniprot KB | |
| Antigen Synonym Names | Cyclic AMP-dependent transcription factor ATF-4 , cAMP-dependent transcription factor ATF-4 , Activating transcription factor 4 , Cyclic AMP-responsive element-binding protein 2 , CREB-2 , cAMP-responsive element-binding protein 2 , Tax-responsive enhancer element-binding protein 67 , TaxREB67 |
| Antigen Synonyms | ATF4;CREB2;TXREB |
| Antigen Species | Homo sapiens |
| Antigen Species ID |
Domain Name: bZIP_ATF4 Domain ID: Atf4 [2-78]Antigen Source Lab ID: Atf4 [2-78] Antigen Source Lab: RAN Antigen Protein Sequence Position: 276 Antigen Protein Sequence: MKIEEHHHHHHSSGKLGSTGGGLNDIFEAQKIEWHEEDLYFQSAAQPAEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIE Binders dropdown end: |
| HGNC | |
|---|---|
| GeneCards | |
| MGI | |
| MIM | |
| eggNOG | |
| INPARANOID | |
| OrthoDb | |
| TreeFam | |
| InterPro | |
| PFAM | |
| PROSITE | |
| SMART | |
| PIR | |
| RefSeq | |
| Ensembl | |
| GeneID | |
| KEGG | |
| UCSC | |
| BioGrid | |
| DIP | |
| STRING | |
| IntAct | |
| Mint | |
| PDB | |
| DMDM | |
| ChiTaRS | |
| Antigen Citation |
Quick links
Latest publications
-
Conformation-specific Synthetic Antibodies Discriminate Multiple Functional States of the Ion Channel CorA. (published on 2023 Jul 01)
-
Structural basis for assembly and lipid-mediated gating of LRRC8A:C volume-regulated anion channels. (published on 2023 Mar 16)
