ZSCAN5B
Antigen Gene Symbol | ZSCAN5B |
---|---|
Antigen Protein Name | zinc finger and SCAN domain containing 5B |
Antigen Source Species | E. coli |
Antigen Source Species ID | 562 |
Antigen Organism ID | |
Antigen Uniprot AC | |
Antigen Uniprot KB | |
Antigen Synonym Names | Zinc finger and SCAN domain-containing protein 5B |
Antigen Synonyms | ZSCAN5B |
Antigen Species | Homo sapiens |
Antigen Species ID |
Domain Name: SCAN Domain ID: HR8432B.004Antigen Source Lab ID: HR8432B.004 Antigen Source Lab: Rutgers Antigen Protein Sequence Position: 41 Antigen Protein Sequence: MSGLNDIFEAQKIEWHEHHHHHHENLYFQSHMETWHMNFRMFSCPEESDPIQALRKLTELCHLWLRPDLHTKEQILDMLVMEQFMISMPQELQVLVKVNGVQSCKDLEDLLRNNRRPK Binders dropdown end: |
HGNC | |
---|---|
GeneCards | |
MGI | |
eggNOG | |
INPARANOID | |
OrthoDb | |
TreeFam | |
InterPro | |
PFAM | |
PROSITE | |
SMART | |
RefSeq | |
Ensembl | |
GeneID | |
KEGG | |
UCSC | |
BioGrid | |
STRING | |
IntAct | |
Antigen Citation |
Quick links
Latest publications
-
Conformation-specific Synthetic Antibodies Discriminate Multiple Functional States of the Ion Channel CorA. (published on 2023 Jul 01)
-
Structural basis for assembly and lipid-mediated gating of LRRC8A:C volume-regulated anion channels. (published on 2023 Mar 16)