POU2F3

Antigen Information
Antigen Gene Symbol
POU2F3
Antigen Protein Name
POU class 2 homeobox 3
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
POU domain, class 2, transcription factor 3
, Octamer-binding protein 11
, Oct-11
, Octamer-binding transcription factor 11
, OTF-11
, Transcription factor PLA-1
, Transcription factor Skn-1
Antigen Synonyms
POU2F3;OTF11;PLA1
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
homeodomain
Domain ID: 

Pou2f3 [4-11]

Antigen Source Lab ID: 
Pou2f3 [4-11]
Antigen Source Lab: 
RAN
Antigen Protein Sequence Position: 
282-338
Antigen Protein Sequence: 
MKIEEHHHHHHSSGKLGSTGGGLNDIFEAQKIEWHEEDLYFQSAAQPARKKRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKR

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium