NR2F6

Antigen Information
Antigen Gene Symbol
NR2F6
Antigen Protein Name
nuclear receptor subfamily 2, group F, member 6
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
Nuclear receptor subfamily 2 group F member 6
, V-erbA-related protein 2
, EAR-2
Antigen Synonyms
NR2F6;EAR2;ERBAL2
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
NR_LBD_COUP-TF
Domain ID: 

Nr2f6 [4_5]

Antigen Source Lab ID: 
Nr2f6 [4_5]
Antigen Source Lab: 
RAN
Antigen Protein Sequence Position: 
163-397
Antigen Protein Sequence: 
MKIEEHHHHHHSSGKLGSTGGGLNDIFEAQKIEWHEEDLYFQSAAQPAGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFN

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium