ZNF639

Antigen Information
Antigen Gene Symbol
ZNF639
Antigen Protein Name
zinc finger protein 639
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
Zinc finger protein 639
, Zinc finger protein ANC_2H01
, Zinc finger protein ZASC1
Antigen Synonyms
ZNF639;ZASC1
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
ZF_C2H2
Domain ID: 

HR7646A.006

Antigen Source Lab ID: 
HR7646A.006
Antigen Source Lab: 
Rutgers
Antigen Protein Sequence Position: 
406-485
Antigen Protein Sequence: 
MGHHHHHHSHMDDCGKGFSSMLEYCKHLNSHLSEGIYLCQYCEYSTGQIEDLKIHLDFKHSADLPHKCSDCLMRFGNERELISHLPVHETT

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium