PRDM10

Antigen Information
Antigen Gene Symbol
PRDM10
Antigen Protein Name
PR domain containing 10
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
PR domain zinc finger protein 10
, EC 2.1.1.-
, PR domain-containing protein 10
, Tristanin
Antigen Synonyms
PRDM10;KIAA1231;PFM7;TRIS
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
SET
Domain ID: 

PRDM10-A002

Antigen Source Lab ID: 
PRDM10-A002
Antigen Source Lab: 
SGC
Antigen Protein Sequence Position: 
158-351
Antigen Protein Sequence: 
MHHHHHHHHHHDLGTENLYFQSMDDWEPDPPRPFDPHDLWCEECNNAHASVCPKHGPLHPIPNRPVLTRARASLPLVLYIDRFLGGVFSKRRIPKRTQFGPVEGPLVRGSELKDCYIHLKVSLDKGDRKERDLHEDLWFELSDETLCNWMMFVRPAQNHLEQNLVAYQYGHHVYYTTIKNVEPKQELKVWYAASYAEFVNQKIHDISEEERKVLREQSSKGGYGLNDIFEAQKIEWHE

PRDM10-A003

Antigen Source Lab ID: 
PRDM10-A003
Antigen Source Lab: 
SGC
Antigen Protein Sequence Position: 
158-351
Antigen Protein Sequence: 
MHHHHHHHHHHDLGTENLYFQSMDDWEPDPPRPFDPHDLWCEECNNAHASVCPKHGPLHPIPNRPVLTRARASLPLVLYIDRFLGGVFSKRRIPKRTQFGPVEGPLVRGSELKDCYIHLKVSLDKGDRKERDLHEDLWFELSDETLCNWMMFVRPAQNHLEQNLVAYQYGHHVYYTTIKNVEPKQELKVWYAASYAEFVNQKIHDISEEERKVLREQSSKGGYGLNDIFEAQKIEWHE

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium