PRDM1

Antigen Information
Antigen Gene Symbol
PRDM1
Antigen Protein Name
PR domain containing 1, with ZNF domain
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
PR domain zinc finger protein 1
, EC 2.1.1.-
, BLIMP-1
, Beta-interferon gene positive regulatory domain I-binding factor
, PR domain-containing protein 1
, Positive regulatory domain I-binding factor 1
, PRDI-BF1
, PRDI-binding factor 1
Antigen Synonyms
PRDM1;BLIMP1
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
SET
Domain ID: 

PRDM1-A004

Antigen Source Lab ID: 
PRDM1-A004
Antigen Source Lab: 
SGC
Antigen Protein Sequence Position: 
38-223
Antigen Protein Sequence: 
MSGLNDIFEAQKIEWHEGSAGGSGKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQGGSGHHHHHH

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium