POU6F1

Antigen Information
Antigen Gene Symbol
POU6F1
Antigen Protein Name
POU class 6 homeobox 1
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
POU domain, class 6, transcription factor 1
, Brain-specific homeobox/POU domain protein 5
, Brain-5
, Brn-5
, mPOU homeobox protein
Antigen Synonyms
POU6F1;BRN5;MPOU;TCFB1
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
homeodomain
Domain ID: 

Pou6f1 [3-40]

Antigen Source Lab ID: 
Pou6f1 [3-40]
Antigen Source Lab: 
RAN
Antigen Protein Sequence Position: 
235-291
Antigen Protein Sequence: 
MKIEEHHHHHHSSGKLGSTGGGLNDIFEAQKIEWHEEDLYFQSAAQPARKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKN

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium