PLAGL1

Antigen Information
Antigen Gene Symbol
PLAGL1
Antigen Protein Name
pleiomorphic adenoma gene-like 1
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
Zinc finger protein PLAGL1
, Lost on transformation 1
, LOT-1
, Pleiomorphic adenoma-like protein 1
, Tumor suppressor ZAC
Antigen Synonyms
PLAGL1;LOT1;ZAC
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
ZF_C2H2
Domain ID: 

HR7895A.004

Antigen Source Lab ID: 
HR7895A.004
Antigen Source Lab: 
Rutgers
Antigen Protein Sequence Position: 
159-199
Antigen Protein Sequence: 
MSGLNDIFEAQKIEWHEHHHHHHENLYFQSHMDHCERCFYTRKDVRRHLVVHTGCKDFLCQFCAQRFGRKDHL

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium