PITX1

Antigen Information
Antigen Gene Symbol
PITX1
Antigen Protein Name
paired-like homeodomain 1
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
Pituitary homeobox 1
, Hindlimb-expressed homeobox protein backfoot
, Homeobox protein PITX1
, Paired-like homeodomain transcription factor 1
Antigen Synonyms
PITX1;BFT;PTX1
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
homeodomain
Domain ID: 

Pitx1

Antigen Source Lab ID: 
Pitx1
Antigen Source Lab: 
RAN
Antigen Protein Sequence Position: 
90-146
Antigen Protein Sequence: 
MKIEEHHHHHHSSGKLGSTEDLYFQSAAQPARRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRK

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium