PIKFYVE

Antigen Information
Antigen Gene Symbol
PIKFYVE
Antigen Protein Name
phosphoinositide kinase, FYVE finger containing
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
1-phosphatidylinositol 3-phosphate 5-kinase
, Phosphatidylinositol 3-phosphate 5-kinase
, EC 2.7.1.150
, FYVE finger-containing phosphoinositide kinase
, PIKfyve
, Phosphatidylinositol 3-phosphate 5-kinase type III
, PIPkin-III
, Type III PIP kinase
Antigen Synonyms
PIKFYVE;KIAA0981;PIP5K3
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
DEP_PIKfyve
Domain ID: 

HR7108D.015

Antigen Source Lab ID: 
HR7108D.015
Antigen Source Lab: 
Rutgers
Antigen Protein Sequence Position: 
342-488
Antigen Protein Sequence: 
MSGLNDIFEAQKIEWHEHHHHHHENLYFQSHMTEDERKILLDSVQLKDLWKKICHHSSGMEFQDHRYWLRTHPNCIVGKELVNWLIRNGHIATRAQAIAIGQAMVDGRWLDCVSHHDQLFRDEYALYRPLQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNL

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium