PHF20L1

Antigen Information
Antigen Gene Symbol
PHF20L1
Antigen Protein Name
PHD finger protein 20-like 1
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
PHD finger protein 20-like protein 1
Antigen Synonyms
PHF20L1;CGI-72
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
MBT
Domain ID: 

PHF20L1-A001

Antigen Source Lab ID: 
PHF20L1-A001
Antigen Source Lab: 
SGC
Antigen Protein Sequence Position: 
1-81
Antigen Protein Sequence: 
MSGLNDIFEAQKIEWHEGSAGGSGMSKKPPNRPGITFEIGARLEALDYLQKWYPSRIEKIDYEEGKMLVHFERWSHRYDEWIYWDSNRLRPLERPALRKEGLKDEGGSGHHHHHH

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium