PGBD1

Antigen Information
Antigen Gene Symbol
PGBD1
Antigen Protein Name
piggyBac transposable element derived 1
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
PiggyBac transposable element-derived protein 1
, Cerebral protein 4
Antigen Synonyms
PGBD1;hucep-4
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
SCAN
Domain ID: 

HR2735A.005

Antigen Source Lab ID: 
HR2735A.005
Antigen Source Lab: 
Rutgers
Antigen Protein Sequence Position: 
6-150
Antigen Protein Sequence: 
MSGLNDIFEAQKIEWHEHHHHHHENLYFQSHMPGPAPENEDGLVKVKEEDPTWEQVCNSQEGSSHTQEICRLRFRHFCYQEAHGPQEALAQLRELCHQWLRPEMHTKEQIMELLVLEQFLTILPKELQPCVKTYPLESGEEAVTVLENLETGSGDTGQQASVYIQGQDMHPMVAEYQ
Antigen Reference
HGNC
GeneCards
MGI
eggNOG
GeneTree
HOGENOME
HOVERGREN
INPARANOID
OrthoDb
TreeFam
InterPro
PFAM
PROSITE
SMART
EMBL
RefSeq
UniGene
Ensembl
GeneID
KEGG
UCSC
BioGrid
STRING
IntAct
DMDM
Antigen Citation

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium