PGBD1

Antigen Information
Antigen Gene Symbol
PGBD1
Antigen Protein Name
piggyBac transposable element derived 1
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
PiggyBac transposable element-derived protein 1
, Cerebral protein 4
Antigen Synonyms
PGBD1;hucep-4
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
SCAN
Domain ID: 

HR2735A.005

Antigen Source Lab ID: 
HR2735A.005
Antigen Source Lab: 
Rutgers
Antigen Protein Sequence Position: 
6-150
Antigen Protein Sequence: 
MSGLNDIFEAQKIEWHEHHHHHHENLYFQSHMPGPAPENEDGLVKVKEEDPTWEQVCNSQEGSSHTQEICRLRFRHFCYQEAHGPQEALAQLRELCHQWLRPEMHTKEQIMELLVLEQFLTILPKELQPCVKTYPLESGEEAVTVLENLETGSGDTGQQASVYIQGQDMHPMVAEYQ

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium