PBRM1

Antigen Information
Antigen Gene Symbol
PBRM1
Antigen Protein Name
polybromo 1
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
Protein polybromo-1
, hPB1
, BRG1-associated factor 180
, BAF180
, Polybromo-1D
Antigen Synonyms
PBRM1;BAF180;PB1
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
Bromo_polybromo_II
Domain ID: 

PB1A

Antigen Source Lab ID: 
PB1A
Antigen Source Lab: 
SGC
Antigen Protein Sequence Position: 
178-291
Antigen Protein Sequence: 
MHHHHHHHHHHSSGVDLGTENLYFQSMSPAYLKEILEQLLEAIVVATNPSGRLISELFQKLPSKVQYPDYYAIIKEPIDLKTIAQRIQNGSYKSIHAMAKDIDLLAKNAKTYNEPGSQVFKDANSIKKIFYMKKAEIEHHE

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium