PBK

Antigen Information
Antigen Gene Symbol
PBK
Antigen Protein Name
PDZ binding kinase
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
Lymphokine-activated killer T-cell-originated protein kinase
, EC 2.7.12.2
, Cancer/testis antigen 84
, CT84
, MAPKK-like protein kinase
, Nori-3
, PDZ-binding kinase
, Spermatogenesis-related protein kinase
, SPK
, T-LAK cell-originated protein kinase
Antigen Synonyms
PBK;TOPK
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
PKc_TOPK
Domain ID: 

TOPKA-A004

Antigen Source Lab ID: 
TOPKA-A004
Antigen Source Lab: 
SGC
Antigen Protein Sequence Position: 
1-966
Antigen Protein Sequence: 
MSGLNDIFEAQKIEWHEGSAGGSGMEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDVGGSGHHHHHH

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium