PAX7

Antigen Information
Antigen Gene Symbol
PAX7
Antigen Protein Name
paired box 7
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
Paired box protein Pax-7
, HuP1
Antigen Synonyms
PAX7;HUP1
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
homeodomain
Domain ID: 

Pax7 [3-4]

Antigen Source Lab ID: 
Pax7 [3-4]
Antigen Source Lab: 
RAN
Antigen Protein Sequence Position: 
218-274
Antigen Protein Sequence: 
MKIEEHHHHHHSSGKLGSTGGGLNDIFEAQKIEWHEEDLYFQSAAQPARRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQRTKLTEARVQVWFSNRRARWRK

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium