PAX6

Antigen Information
Antigen Gene Symbol
PAX6
Antigen Protein Name
paired box 6
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
Paired box protein Pax-6
, Aniridia type II protein
, Oculorhombin
Antigen Synonyms
PAX6;AN2
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
homeodomain
Domain ID: 

Pax6 [2-69]

Antigen Source Lab ID: 
Pax6 [2-69]
Antigen Source Lab: 
RAN
Antigen Protein Sequence Position: 
211-267
Antigen Protein Sequence: 
MKIEEHHHHHHSSGKLGSTGGGLNDIFEAQKIEWHEEDLYFQSAAQPAQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRR

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium