OTX2

Antigen Information
Antigen Gene Symbol
OTX2
Antigen Protein Name
orthodenticle homeobox 2
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
Homeobox protein OTX2
, Orthodenticle homolog 2
Antigen Synonyms
OTX2
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
homeodomain
Domain ID: 

Otx2 [3-7]

Antigen Source Lab ID: 
Otx2 [3-7]
Antigen Source Lab: 
RAN
Antigen Protein Sequence Position: 
39-95
Antigen Protein Sequence: 
MKIEEHHHHHHSSGKLGSTGGGLNDIFEAQKIEWHEEDLYFQSAAQPARRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQ

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium