NR6A1

Antigen Information
Antigen Gene Symbol
NR6A1
Antigen Protein Name
nuclear receptor subfamily 6, group A, member 1
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
Nuclear receptor subfamily 6 group A member 1
, Germ cell nuclear factor
, GCNF
, hGCNF
, Retinoid receptor-related testis-specific receptor
, RTR
, hRTR
Antigen Synonyms
NR6A1;GCNF
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
NR_DBD_like
Domain ID: 

HR7049C.002

Antigen Source Lab ID: 
HR7049C.002
Antigen Source Lab: 
Rutgers
Antigen Protein Sequence Position: 
53-163
Antigen Protein Sequence: 
MSGLNDIFEAQKIEWHEHHHHHHENLYFQSHMDRAEQRTCLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVMSRKQRNRCQYCRLLKCLQMGMNRKAIREDGMPGGRNKSIGPVQISEEEIERIMSGQEFE

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium