NR1D2

Antigen Information
Antigen Gene Symbol
NR1D2
Antigen Protein Name
nuclear receptor subfamily 1, group D, member 2
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
Nuclear receptor subfamily 1 group D member 2
, Orphan nuclear hormone receptor BD73
, Rev-erb alpha-related receptor
, RVR
, Rev-erb-beta
, V-erbA-related protein 1-related
, EAR-1R
Antigen Synonyms
NR1D2
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
NR_LBD_REV_ERB
Domain ID: 

HR8341C.001

Antigen Source Lab ID: 
HR8341C.001
Antigen Source Lab: 
Rutgers
Antigen Protein Sequence Position: 
398-579
Antigen Protein Sequence: 
MSGLNDIFEAQKIEWHEHHHHHHENLYFQSHMGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium