NFIL3

Antigen Information
Antigen Gene Symbol
NFIL3
Antigen Protein Name
nuclear factor, interleukin 3 regulated
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
Nuclear factor interleukin-3-regulated protein
, E4 promoter-binding protein 4
, Interleukin-3 promoter transcriptional activator
, Interleukin-3-binding protein 1
, Transcriptional activator NF-IL3A
Antigen Synonyms
NFIL3;E4BP4;IL3BP1
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
bZIP
Domain ID: 

NfiI3 [3-52]

Antigen Source Lab ID: 
NfiI3 [3-52]
Antigen Source Lab: 
RAN
Antigen Protein Sequence Position: 
49-104
Antigen Protein Sequence: 
MKIEEHHHHHHSSGKLGSTGGGLNDIFEAQKIEWHEEDLYFQSAAQPAKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELLSLKLKFG

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium