MZF1

Antigen Information
Antigen Gene Symbol
MZF1
Antigen Protein Name
myeloid zinc finger 1
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
Myeloid zinc finger 1
, MZF-1
, Zinc finger and SCAN domain-containing protein 6
, Zinc finger protein 42
Antigen Synonyms
MZF1;MZF;ZNF42;ZSCAN6
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
SCAN
Domain ID: 

HR7215A.005

Antigen Source Lab ID: 
HR7215A.005
Antigen Source Lab: 
Rutgers
Antigen Protein Sequence Position: 
37-128
Antigen Protein Sequence: 
MSGLNDIFEAQKIEWHEHHHHHHENLYFQSHMDPGPEAARLRFRCFRYEEATGPQEALAQLRELCRQWLRPEVRSKEQMLELLVLEQFLGALPPEIQARVQGQRPGSPEEAAALVDGLRREPGG

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium