MTF2

Antigen Information
Antigen Gene Symbol
MTF2
Antigen Protein Name
metal response element binding transcription factor 2
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
Metal-response element-binding transcription factor 2
, Metal regulatory transcription factor 2
, Metal-response element DNA-binding protein M96
, Polycomb-like protein 2
, hPCl2
Antigen Synonyms
MTF2;PCL2
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
PHD1_MTF2
Domain ID: 

PCL2-A001

Antigen Source Lab ID: 
PCL2-A001
Antigen Source Lab: 
SGC
Antigen Protein Sequence Position: 
30-162
Antigen Protein Sequence: 
MSGLNDIFEAQKIEWHEGSAGGSGKLSLQDGHKAKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDCSVIDSDEKWLCRQCVFATTTKRGGSGHHHHHH

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium