MTA1

Antigen Information
Antigen Gene Symbol
MTA1
Antigen Protein Name
metastasis associated 1
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
Metastasis-associated protein MTA1
Antigen Synonyms
MTA1
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
SANT_MTA3_like
Domain ID: 

MTA1

Antigen Source Lab ID: 
MTA1
Antigen Source Lab: 
RAN
Antigen Protein Sequence Position: 
269-460
Antigen Protein Sequence: 
MGSSHHHHHHGSGGISALVPQGGPVLCRDEMEEWSASEANLFEEALEKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPNYNKPNPNQISVNNVKAGVVNGTGAPGQSPGAGRACESCYTTQSYQWYSWGPPNMQCRLCASCWTYWKKYGGLKMPTRLDGERPGPNRSNMSPHGLPARSSGGGLNDIFEAQKIEWHE

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium