MSH6

Antigen Information
Antigen Gene Symbol
MSH6
Antigen Protein Name
mutS homolog 6
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
DNA mismatch repair protein Msh6
, hMSH6
, G/T mismatch-binding protein
, GTBP
, GTMBP
, MutS protein homolog 6
, MutS-alpha 160 kDa subunit
, p160
Antigen Synonyms
MSH6;GTBP
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
MSH6_like
Domain ID: 

MSH6-A001

Antigen Source Lab ID: 
MSH6-A001
Antigen Source Lab: 
SGC
Antigen Protein Sequence Position: 
89-203
Antigen Protein Sequence: 
MSGLNDIFEAQKIEWHEGSAGGSGDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADEALNKDKIKRLELAVCDEPSEPEGGSGHHHHHH
Antigen Reference
HGNC
GeneCards
MGI
MIM
eggNOG
GeneTree
HOGENOME
HOVERGREN
INPARANOID
KO
OrthoDb
TreeFam
InterPro
PFAM
PROSITE
SMART
EMBL
PIR
RefSeq
UniGene
Ensembl
GeneID
KEGG
UCSC
BioGrid
DIP
STRING
IntAct
Mint
PDB
Reactome
DNASU
DMDM
ChiTaRS
Antigen Citation

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium