MPHOSPH8

Antigen Information
Antigen Gene Symbol
MPHOSPH8
Antigen Protein Name
M-phase phosphoprotein 8
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
M-phase phosphoprotein 8
, Two hybrid-associated protein 3 with RanBPM
, Twa3
Antigen Synonyms
MPHOSPH8;MPP8
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
CHROMO
Domain ID: 

MPP8-A002

Antigen Source Lab ID: 
MPP8-A002
Antigen Source Lab: 
SGC
Antigen Protein Sequence Position: 
58-118
Antigen Protein Sequence: 
MSGLNDIFEAQKIEWHEGSAGGSGVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKAKAVGGSGHHHHHH

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium