DVL2
Antigen Gene Symbol | DVL2 |
---|---|
Antigen Protein Name | dishevelled segment polarity protein 2 |
Antigen Source Species | E. coli |
Antigen Source Species ID | 562 |
Antigen Organism ID | |
Antigen Uniprot AC | |
Antigen Uniprot KB | |
Antigen Synonym Names | Segment polarity protein dishevelled homolog DVL-2 , Dishevelled-2 , DSH homolog 2 |
Antigen Synonyms | DVL2 |
Antigen Species | Homo sapiens |
Antigen Species ID |
Domain Name: DEP_dishevelled Domain ID: HR5528A.009Antigen Source Lab ID: HR5528A.009 Antigen Source Lab: Rutgers Antigen Protein Sequence Position: 401 Antigen Protein Sequence: MGHHHHHHSHMTITSGSSLPDGCEGRGLSVHTDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAGLIRHTVNKITFSEQCYYVFGDLSGGC Binders dropdown end: |
HGNC | |
---|---|
GeneCards | |
MGI | |
MIM | |
eggNOG | |
INPARANOID | |
OrthoDb | |
TreeFam | |
InterPro | |
PFAM | |
PROSITE | |
SMART | |
RefSeq | |
Ensembl | |
GeneID | |
KEGG | |
UCSC | |
BioGrid | |
DIP | |
STRING | |
IntAct | |
Mint | |
PDB | |
ChiTaRS | |
Antigen Citation |
Quick links
Latest publications
-
Conformation-specific Synthetic Antibodies Discriminate Multiple Functional States of the Ion Channel CorA. (published on 2023 Jul 01)
-
Structural basis for assembly and lipid-mediated gating of LRRC8A:C volume-regulated anion channels. (published on 2023 Mar 16)