SRY
Antigen Gene Symbol | SRY |
---|---|
Antigen Protein Name | sex determining region Y |
Antigen Source Species | E. coli |
Antigen Source Species ID | 562 |
Antigen Organism ID | |
Antigen Uniprot AC | |
Antigen Uniprot KB | |
Antigen Synonym Names | Sex-determining region Y protein , Testis-determining factor |
Antigen Synonyms | SRY;TDF |
Antigen Species | Homo sapiens |
Antigen Species ID |
Domain Name: SOX-TCF_HMG-box Domain ID: HR6924A.005Antigen Source Lab ID: HR6924A.005 Antigen Source Lab: Rutgers Antigen Protein Sequence Position: 56 Antigen Protein Sequence: MSGLNDIFEAQKIEWHEHHHHHHENLYFQSHMVQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRP Binders dropdown end: |
HGNC | |
---|---|
GeneCards | |
MGI | |
MIM | |
INPARANOID | |
OrthoDb | |
InterPro | |
PFAM | |
PROSITE | |
SMART | |
PIR | |
RefSeq | |
Ensembl | |
GeneID | |
KEGG | |
UCSC | |
BioGrid | |
IntAct | |
Mint | |
PDB | |
DMDM | |
Antigen Citation | ; 8434602 ; 8244390 ; 7557997 ; 15489334 ; 1425584 ; 8265659 ; 8159753 ; 9054412 ; 9525897 ; 10732804 ; 11818535 ; 12970737 ; 12764225 ; 12871148 ; 15170344 ; 15297880 ; 15469996 ; 15746192 ; 16762365 ; 16904257 ; 16996051 ; 16414182 ; 7774012 ; 11563911 ; 16813837 ; 8257986 ; 9143916 ; 2247149 ; 8353496 ; 1570829 ; 1415266 ; 1339396 ; 8447323 ; 1483689 ; 8105086 ; 8019555 ; 7985018 ; 7717397 ; 7776083 ; 9678356 ; 9521592 ; 9450909 ; 9652903 ; 10670762 ; 10602113 ; 10852465 ; 10843173 ; 10721678 ; 12107262 ; 12793612 ; 17063144 ; 28030592 |
Quick links
Latest publications
-
Conformation-specific Synthetic Antibodies Discriminate Multiple Functional States of the Ion Channel CorA. (published on 2023 Jul 01)
-
Structural basis for assembly and lipid-mediated gating of LRRC8A:C volume-regulated anion channels. (published on 2023 Mar 16)