POU2F3
Antigen Gene Symbol | POU2F3 |
---|---|
Antigen Protein Name | POU class 2 homeobox 3 |
Antigen Source Species | E. coli |
Antigen Source Species ID | 562 |
Antigen Organism ID | |
Antigen Uniprot AC | |
Antigen Uniprot KB | |
Antigen Synonym Names | POU domain class 2 transcription factor 3 , Octamer-binding protein 11 , Oct-11 , Octamer-binding transcription factor 11 , OTF-11 , Transcription factor PLA-1 , Transcription factor Skn-1 |
Antigen Synonyms | POU2F3;OTF11;PLA1 |
Antigen Species | Homo sapiens |
Antigen Species ID |
Domain Name: homeodomain Domain ID: Pou2f3 [4-11]Antigen Source Lab ID: Pou2f3 [4-11] Antigen Source Lab: RAN Antigen Protein Sequence Position: 282 Antigen Protein Sequence: MKIEEHHHHHHSSGKLGSTGGGLNDIFEAQKIEWHEEDLYFQSAAQPARKKRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKR Binders dropdown end: |
HGNC | |
---|---|
GeneCards | |
MGI | |
MIM | |
eggNOG | |
INPARANOID | |
OrthoDb | |
TreeFam | |
InterPro | |
PFAM | |
PROSITE | |
SMART | |
RefSeq | |
Ensembl | |
GeneID | |
KEGG | |
UCSC | |
BioGrid | |
STRING | |
IntAct | |
DMDM | |
ChiTaRS | |
Antigen Citation |
Quick links
Latest publications
-
Conformation-specific Synthetic Antibodies Discriminate Multiple Functional States of the Ion Channel CorA. (published on 2023 Jul 01)
-
Structural basis for assembly and lipid-mediated gating of LRRC8A:C volume-regulated anion channels. (published on 2023 Mar 16)