News

MSH6

Antigen Information

Antigen Gene Symbol: MSH6
Antigen Protein Name: mutS homolog 6
Antigen Source Species: E. coli
Antigen Source Species ID: 562
Antigen Organism ID: 9606
Antigen Uniprot AC: P52701
Antigen Uniprot KB: MSH6_HUMAN
Antigen Species: Homo sapiens
Antigen Species ID: 9606

Binders

Binder Name: anti-MSH6-RAB-C104
Binder Name: anti-MSH6-RAB-C105
Binder Name: anti-MSH6-RAB-C164
Binder Name: anti-MSH6-RAB-C141
Binder Name: anti-MSH6-RAB-C106

Antigen Protein Domain and Sequence

Domain Name: MSH6_like
Domain ID: 99898
Antigen Source Lab ID: MSH6-A001
Antigen Source Lab: SGC
Antigen Protein Sequence Position: 89
Antigen Protein Sequence: MSGLNDIFEAQKIEWHEGSAGGSGDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADEALNKDKIKRLELAVCDEPSEPEGGSGHHHHHH

Antigen Reference

Antigen Citation: 8942985; 9455487; 14702039; 15815621; 15489334; 7604265; 8838326; 7604264; 9822680; 9822679; 9564049; 9889267; 10078208; 10660545; 15064730; 15808853; 10783165; 9354786; 17081983; 16964243; 17557300; 17525332; 18220336; 18691976; 18669648; 19608861; 20068231; 21269460; 21406692; 23186163; 21120944; 21957315; 23622243; 26300262; 17531815; 7604266; 10521294; 10537275; 10480359; 10413423; 11153917; 10699937; 11470537; 11586295; 11709755; 11807791; 12658575; 12522549; 14520694; 15354210; 14974087; 15365995; 14961575; 15483016; 17344846; 18033691; 22102614; 22581703
BioGrid: 109211
ChiTaRS: MSH6
DIP: 32972
DMDM: 68067672
eggNOG: KOG0217
Ensembl: ENST00000234420 [P52701-1]; ENST00000538136 [P52701-4]; ENST00000540021 [P52701-3]; ENST00000614496 [P52701-4]
GeneCards: MSH6
GeneID: 2956
HOGENOME: CLU_002472_1_3_1
INPARANOID: P52701
IntAct: P52701
InterPro: IPR007695; IPR017261; IPR000432; IPR007861; IPR007696; IPR016151; IPR036187; IPR007860; IPR036678; IPR027417; IPR000313
KEGG: hsa:2956
MGI: MGI:1343961
MIM: 114500; 276300; 600678; 608089; 614350
MINT: P52701
OrthoDb: 138168at2759
PDB: 2GFU; 2O8B; 2O8C; 2O8D; 2O8E; 2O8F; 6OQM
PFAM: PF01624; PF05188; PF05192; PF05190; PF00488; PF00855
PIR: JC5839
PROSITE: PS00486; PS50812
RefSeq: NP_000170.1 [P52701-1]; NP_001268421.1 [P52701-3]; NP_001268422.1 [P52701-4]; NP_001268423.1 [P52701-4]
SMART: SM00534; SM00533; SM00293
STRING: 9606.ENSP00000234420
TreeFam: TF105842
UCSC: uc002rwd.5
Back to Catalog
Scroll to Top