CBX3
Antigen Gene Symbol | CBX3 |
---|---|
Antigen Protein Name | chromobox homolog 3 |
Antigen Source Species | E. coli |
Antigen Source Species ID | 562 |
Antigen Organism ID | |
Antigen Uniprot AC | |
Antigen Uniprot KB | |
Antigen Synonym Names | Chromobox protein homolog 3 , HECH , Heterochromatin protein 1 homolog gamma , HP1 gamma , Modifier 2 protein |
Antigen Synonyms | CBX3 |
Antigen Species | Homo sapiens |
Antigen Species ID |
Domain Name: CHROMO Domain ID: CBX3A-A001Antigen Source Lab ID: CBX3A-A001 Antigen Source Lab: SGC Antigen Protein Sequence Position: 29 Antigen Protein Sequence: MHHHHHHHHHHDLGTENLYFQSMEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEK Binders dropdown end: |
HGNC | |
---|---|
GeneCards | |
MGI | |
MIM | |
eggNOG | |
INPARANOID | |
OrthoDb | |
TreeFam | |
InterPro | |
PFAM | |
PROSITE | |
SMART | |
RefSeq | |
Ensembl | |
GeneID | |
KEGG | |
UCSC | |
BioGrid | |
DIP | |
STRING | |
IntAct | |
Mint | |
PDB | |
DMDM | |
ChiTaRS | |
Antigen Citation | ; 10664448 ; 15489334 ; 9169472 ; 9864353 ; 9636146 ; 10460410 ; 10330177 ; 11242053 ; 12004135 ; 15502821 ; 17081983 ; 16964243 ; 18691976 ; 18669648 ; 18318008 ; 19608861 ; 20850016 ; 19880879 ; 25750265 ; 20562864 ; 20068231 ; 21269460 ; 21346195 ; 21406692 ; 23251473 ; 23186163 ; 23542155 ; 24275569 ; 25218447 ; 25772364 ; 25755297 ; 25944712 ; 28167679 ; 28112733 |
Quick links
Latest publications
-
Conformation-specific Synthetic Antibodies Discriminate Multiple Functional States of the Ion Channel CorA. (published on 2023 Jul 01)
-
Structural basis for assembly and lipid-mediated gating of LRRC8A:C volume-regulated anion channels. (published on 2023 Mar 16)