ARNT

Antigen Information
Antigen Gene Symbol
ARNT
Antigen Protein Name
aryl hydrocarbon receptor nuclear translocator
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
Aryl hydrocarbon receptor nuclear translocator,
ARNT protein,
Class E basic helix-loop-helix protein 2,
bHLHe2,
Dioxin receptor, nuclear translocator,
Hypoxia-inducible factor 1-beta,
HIF-1-beta,
HIF1-beta
Antigen Synonyms
ARNT,
BHLHE2
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
PAS
Domain ID: 

Arnt-Domain1 [1_36]

Antigen Source Lab ID: 
Arnt-Domain1 [1_36]
Antigen Source Lab: 
RAN
Antigen Protein Sequence Position: 
356-466
Antigen Protein Sequence: 
MKIEEHHHHHHSSGKLGSTGGGLNDIFEAQKIEWHEEDLYFQSAAQPANVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKN

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium