ASF1B

Antigen Information
Antigen Gene Symbol
ASF1B
Antigen Protein Name
anti-silencing function 1B histone chaperone
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
Histone chaperone ASF1B,
Anti-silencing function protein 1 homolog B,
hAsf1,
hAsf1b,
CCG1-interacting factor A-II,
CIA-II,
hCIA-II
Antigen Synonyms
ASF1B
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
ASF1_hist_chap
Domain ID: 

ASF1B-A001

Antigen Source Lab ID: 
ASF1B-A001
Antigen Source Lab: 
SGC
Antigen Protein Sequence Position: 
2-202
Antigen Protein Sequence: 
MSGLNDIFEAQKIEWHEGSAGGSGAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCIGGSGHHHHHH

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium