ATF4

Antigen Information
Antigen Gene Symbol
ATF4
Antigen Protein Name
Activating transcription factor 4
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
bZIP_ATF4
Domain ID: 

Atf4 [2-78]

Antigen Source Lab ID: 
Atf4 [2-78]
Antigen Source Lab: 
RAN
Antigen Protein Sequence Position: 
276-339
Antigen Protein Sequence: 
MKIEEHHHHHHSSGKLGSTGGGLNDIFEAQKIEWHEEDLYFQSAAQPAEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIE
Antigen Reference
HGNC

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium