ATF1

Antigen Information
Antigen Gene Symbol
ATF1
Antigen Protein Name
Activating transcription factor 1
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
bZIP_CREB1
Domain ID: 

Atf1 [1-57]

Antigen Source Lab ID: 
Atf1 [1-57]
Antigen Source Lab: 
RAN
Antigen Protein Sequence Position: 
211-271
Antigen Protein Sequence: 
MKIEEHHHHHHSSGKLGSTGGGLNDIFEAQKIEWHEEDLYFQSAAQPADPQLKREIRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKDLYSNKSV
Antigen Reference
HGNC

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium