ASH1L

Antigen Information
Antigen Gene Symbol
ASH1L
Antigen Protein Name
ash1 (absent, small, or homeotic)-like (Drosophila)
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
Histone-lysine N-methyltransferase ASH1L,
EC 2.1.1.43,
ASH1-like protein,
huASH1,
Absent small and homeotic disks protein 1 homolog,
Lysine N-methyltransferase 2H
Antigen Synonyms
ASH1L,
KIAA1420,
KMT2H
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
Bromo_ASH1
Domain ID: 

ASH1L-A004

Antigen Source Lab ID: 
ASH1L-A004
Antigen Source Lab: 
SGC
Antigen Protein Sequence Position: 
2433-2564
Antigen Protein Sequence: 
MHHHHHHHHHHDLGTENLYFQSMAEENIEVARAARLAQIFKEICDGIISYKDSSRQALAAPLLNLPPKKKNADYYEKISDPLDLITIEKQILTGYYKTVEAFDADMLKVFRNAEKYYGRKSPVGRDVCRLRKAYYNARHEASAQIDEIVGETASESSKGGYGLNDIFEAQKIEWHE

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium