ASF1B

Antigen Information
Antigen Gene Symbol
ASF1B
Antigen Protein Name
anti-silencing function 1B histone chaperone
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
Histone chaperone ASF1B
, Anti-silencing function protein 1 homolog B
, hAsf1
, hAsf1b
, CCG1-interacting factor A-II
, CIA-II
, hCIA-II
Antigen Synonyms
ASF1B
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
ASF1_hist_chap
Domain ID: 

ASF1B-A001

Antigen Source Lab ID: 
ASF1B-A001
Antigen Source Lab: 
SGC
Antigen Protein Sequence Position: 
2-202
Antigen Protein Sequence: 
MSGLNDIFEAQKIEWHEGSAGGSGAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCIGGSGHHHHHH

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium