ARID4B

Antigen Information
Antigen Gene Symbol
ARID4B
Antigen Protein Name
AT rich interactive domain 4B (RBP1-like)
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
AT-rich interactive domain-containing protein 4B,
ARID domain-containing protein 4B,
180 kDa Sin3-associated polypeptide,
Sin3-associated polypeptide p180,
Breast cancer-associated antigen BRCAA1,
Histone deacetylase complex subunit SAP180,
Retinoblastoma-binding protein 1-like 1
Antigen Synonyms
ARID4B,
BRCAA1,
RBBP1L1,
RBP1L1,
SAP180
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
RBB1NT
Domain ID: 

ARID4B-A003

Antigen Source Lab ID: 
ARID4B-A003
Antigen Source Lab: 
SGC
Antigen Protein Sequence Position: 
167-415
Antigen Protein Sequence: 
MSGLNDIFEAQKIEWHEGSAGGSGKQIDELLGKVVCVDYISLDKKKALWFPALVVCPDCSDEIAVKKDNILVRSFKDGKFTSVPRKDVHEITSDTAPKPDAVLKQAFEQALEFHKSRTIPANWKTELKEDSSSSEAEEEEEEEDDEKEKEDNSSEEEEEIEPFPEERENFLQQLYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFDNIESGAVWKQVYQDLGIPVLNSAAGYNVKCAYKKYLYGFEEYCRSANIEFQMALPEKVVNKGGSGHHHHHH

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium