ANAPC2

Antigen Information
Antigen Gene Symbol
ANAPC2
Antigen Protein Name
anaphase promoting complex subunit 2
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
Anaphase-promoting complex subunit 2,
APC2,
Cyclosome subunit 2
Antigen Synonyms
ANAPC2,
APC2,
KIAA1406
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
APC2
Domain ID: 

HR6941B.004

Antigen Source Lab ID: 
HR6941B.004
Antigen Source Lab: 
Rutgers
Antigen Protein Sequence Position: 
732-822
Antigen Protein Sequence: 
MSGLNDIFEAQKIEWHEHHHHHHENLYFQSHMSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLPKNCS

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium