ATF7

Antigen Information
Antigen Gene Symbol
ATF7
Antigen Protein Name
activating transcription factor 7
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
Cyclic AMP-dependent transcription factor ATF-7,
cAMP-dependent transcription factor ATF-7,
Activating transcription factor 7,
Transcription factor ATF-A
Antigen Synonyms
ATF7,
ATFA
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
bZIP_ATF2
Domain ID: 

Atf7

Antigen Source Lab ID: 
Atf7
Antigen Source Lab: 
RAN
Antigen Protein Sequence Position: 
341-404
Antigen Protein Sequence: 
MKIEEHHHHHHSSGKLGSTEDLYFQSAAQPADPDERRQRFLERNRAAASRCRQKRKLWVSSLEKKAEELTSQNIQLSNEVTLLRNEVAQLKQLLL

BL67-Atf7

Antigen Source Lab ID: 
BL67-Atf7
Antigen Source Lab: 
RAN
Antigen Protein Sequence Position: 
314-405
Antigen Protein Sequence: 
MKIEEHHHHHHSSGKLGGGLNDIFEAQKIEWHEEDLYFQSAAQPADPDERRQRFLERNRAAASRCRQKRKLWVSSLEKKAEELTSQNIQLSNEVTLLRNEVAQLKQLLLAAA

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium