ATAD2

Antigen Information
Antigen Gene Symbol
ATAD2
Antigen Protein Name
ATPase family, AAA domain containing 2
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
ATPase family AAA domain-containing protein 2,
EC 3.6.1.3,
AAA nuclear coregulator cancer-associated protein,
ANCCA
Antigen Synonyms
ATAD2,
L16,
PRO2000
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
Bromo_AAA
Domain ID: 

Atad2

Antigen Source Lab ID: 
Atad2
Antigen Source Lab: 
RAN
Antigen Protein Sequence Position: 
982-1142
Antigen Protein Sequence: 
MSGLNDIFEAQKIEWHEHHHHHHENLYFQSHMEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSTLVGDKRSDPE

ATAD2A-A001

Antigen Source Lab ID: 
ATAD2A-A001
Antigen Source Lab: 
SGC
Antigen Protein Sequence Position: 
981-1108
Antigen Protein Sequence: 
MHHHHHHHHHHDLGTENLYFQSMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESRSSKGGYGLNDIFEAQKIEWHE

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium