ARID3A

Antigen Information
Antigen Gene Symbol
ARID3A
Antigen Protein Name
AT rich interactive domain 3A (BRIGHT-like)
Antigen Source Species
E. coli
Antigen Source Species ID
562
Antigen Organism ID
Antigen Uniprot AC
Antigen Uniprot KB
Antigen Synonym Names
AT-rich interactive domain-containing protein 3A,
ARID domain-containing protein 3A,
B-cell regulator of IgH transcription,
Bright,
Dead ringer-like protein 1,
E2F-binding protein 1
Antigen Synonyms
ARID3A,
DRIL1,
DRIL3,
DRX,
E2FBP1
Antigen Species
Homo sapiens
Antigen Species ID
Antigen Protein Domain and Sequence
Domain Name: 
ARID
Domain ID: 

Arid3a [4_62]

Antigen Source Lab ID: 
Arid3a [4_62]
Antigen Source Lab: 
RAN
Antigen Protein Sequence Position: 
444-541
Antigen Protein Sequence: 
MKIEEHHHHHHSSGKLGSTGGGLNDIFEAQKIEWHEEDLYFQSAAQPAAALEQLREKLESAEPPEKKMALVADEQQRLMQRALQQNFLAMAAQLPMSIRINSQASESRQDSAVNLTGTNGSNSISMSVEINGIMYTGVLFAQPPAP

HR4394C.020

Antigen Source Lab ID: 
HR4394C.020
Antigen Source Lab: 
Rutgers
Antigen Protein Sequence Position: 
218-351
Antigen Protein Sequence: 
MGHHHHHHSHMPDHGDWTYEEQFKQLYELDGDPKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRR

University of Toronto  UCSF  The University of Chicago  QB3  Chicago Biomedical Consortium